PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00346g00073.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family HD-ZIP
Protein Properties Length: 302aa    MW: 33929.2 Da    PI: 8.0272
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00346g00073.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.36.4e-19142196256
                               T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                  Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                               rk+ +++k+q  +Lee F+++++++ +++  LAk+lgL  rqV vWFqNrRa+ k
  Peaxi162Scf00346g00073.1 142 RKKLRLSKDQSAVLEESFKEHHTLNPKQKLALAKRLGLRPRQVEVWFQNRRARTK 196
                               788899***********************************************98 PP

2HD-ZIP_I/II128.72.4e-41142231191
               HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeve 85 
                               +kk+rlsk+q+++LEesF+e+++L+p++K +la++Lgl+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+kev+
  Peaxi162Scf00346g00073.1 142 RKKLRLSKDQSAVLEESFKEHHTLNPKQKLALAKRLGLRPRQVEVWFQNRRARTKLKQTEVDCEFLKRCCENLTEENRRLQKEVQ 226
                               69*********************************************************************************** PP

               HD-ZIP_I/II  86 eLreel 91 
                               eLr +l
  Peaxi162Scf00346g00073.1 227 ELR-AL 231
                               **9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046181.5E-322109IPR006712HD-ZIP protein, N-terminal
Gene3DG3DSA:1.10.10.601.1E-18124192IPR009057Homeodomain-like
SuperFamilySSF466899.61E-19130199IPR009057Homeodomain-like
PROSITE profilePS5007117.362138198IPR001356Homeobox domain
SMARTSM003897.0E-17140202IPR001356Homeobox domain
CDDcd000867.54E-16142199No hitNo description
PfamPF000462.5E-16142196IPR001356Homeobox domain
PRINTSPR000313.1E-5169178IPR000047Helix-turn-helix motif
PROSITE patternPS000270173196IPR017970Homeobox, conserved site
PRINTSPR000313.1E-5178194IPR000047Helix-turn-helix motif
PfamPF021832.3E-11198232IPR003106Leucine zipper, homeobox-associated
SMARTSM003404.2E-27198241IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MMVEREDLGL SLSLSFPVHN KKTTNNPMHQ LNLIPSLASS PFDVIHKTSW TDAFPSSDGN  60
SEACRVETRT FLKGIDVNRL PATADADEEA GVSSPNSTIS SVSGNKRSHE REANNCEEHE  120
MERACSRGNI SNSDEEDGET SRKKLRLSKD QSAVLEESFK EHHTLNPKQK LALAKRLGLR  180
PRQVEVWFQN RRARTKLKQT EVDCEFLKRC CENLTEENRR LQKEVQELRA LKLSPQFYMQ  240
MTPPTTLTMC PSCERVGAPP TSSSSGPTST HMGPAQTRPM PFNLWATTPI SPQPLNAFHP  300
RS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1140146SRKKLRL
2190198RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0107833e-77AP010783.1 Solanum lycopersicum DNA, chromosome 8, clone: C08HBa0006F21, complete sequence.
GenBankHG9755203e-77HG975520.1 Solanum lycopersicum chromosome ch08, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009589459.11e-172PREDICTED: homeobox-leucine zipper protein HAT4-like
SwissprotQ054661e-103HAT4_ARATH; Homeobox-leucine zipper protein HAT4
TrEMBLK4CNI91e-155K4CNI9_SOLLC; Uncharacterized protein
STRINGSolyc08g078300.2.11e-154(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11182485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16780.11e-101homeobox protein 2